PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2DL_54E6F0446.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 143aa    MW: 16045.7 Da    PI: 10.6582
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2DL_54E6F0446.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding55.51.3e-171663148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                           rg+WT+eEd +l+ +++++G  +W++ ++  g+ R++k+c++rw +yl
  Traes_2DL_54E6F0446.1 16 RGSWTPEEDMRLIAYIQKYGHANWRALPKQAGLLRCGKSCRLRWINYL 63
                           89******************************99************97 PP

2Myb_DNA-binding58.21.8e-1869114148
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                            rg++T eE+e l++++++lG++ W++Ia++++ gRt++++k+ w+++l
  Traes_2DL_54E6F0446.1  69 RGNFTVEEEETLIKLHNMLGNK-WSKIAACLP-GRTDNEIKNVWNTHL 114
                            89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-24766IPR009057Homeodomain-like
PROSITE profilePS5129415.1441163IPR017930Myb domain
SuperFamilySSF466897.65E-3213110IPR009057Homeodomain-like
SMARTSM007172.4E-131565IPR001005SANT/Myb domain
PfamPF002494.5E-161663IPR001005SANT/Myb domain
CDDcd001671.29E-101863No hitNo description
PROSITE profilePS5129424.94564118IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-2767118IPR009057Homeodomain-like
SMARTSM007176.7E-1668116IPR001005SANT/Myb domain
PfamPF002499.0E-1769114IPR001005SANT/Myb domain
CDDcd001671.01E-1171114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MGKGRAPCCA KVGLNRGSWT PEEDMRLIAY IQKYGHANWR ALPKQAGLLR CGKSCRLRWI  60
NYLRPDLKRG NFTVEEEETL IKLHNMLGNK WSKIAACLPG RTDNEIKNVW NTHLKKRVAA  120
SAGEQKKGGA KGKKKTTCVD VPA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C7e-301411825128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2486490.0AK248649.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf178a22, mRNA sequence.
GenBankAK3696890.0AK369689.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2095N02.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001151396.11e-82myb-related protein Zm1 isoform 2
RefseqNP_001170453.11e-82myb-related protein Zm1 isoform 1
RefseqXP_003580443.15e-83PREDICTED: myb-related protein Zm1-like
SwissprotP200241e-80MYB1_MAIZE; Myb-related protein Zm1
TrEMBLR7WFT21e-102R7WFT2_AEGTA; Myb-related protein Zm1
TrEMBLW5BUJ31e-102W5BUJ3_WHEAT; Uncharacterized protein
STRINGMLOC_53640.12e-84(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21543798
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.19e-72myb domain protein 63
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]